- NAA11 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-90853
- Human
- Rabbit
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- NAA11
- This antibody was developed against Recombinant Protein corresponding to amino acids: DELRRQMDLK KGGYVVLGSR ENQETQGSTL SDSEEACQQK NPATEESGSD SKEPKESVES TNVQDSSE
- 0.1 ml (also 25ul)
- ARD1B, ARD2, hARD2
- Immunohistochemistry, Immunohistochemistry-Paraffin
- N-alpha-acetyltransferase 11, NatA catalytic subunit
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
DELRRQMDLKKGGYVVLGSRENQETQGSTLSDSEEACQQKNPATEESGSDSKEPKESVESTNVQDSSE
Specifications/Features
Available conjugates: Unconjugated